PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010927035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 175aa    MW: 20684.3 Da    PI: 7.6031
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010927035.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM140.78.6e-44321602128
             NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka..eek.ewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     ppG+rF Ptdeelv++yL++kv+++kl+  + + e d+y+++P++L +k++a  ee+ +wy F++r +kya+g r+nr++  gyWkat +d+++l
  XP_010927035.1  32 PPGVRFTPTDEELVKYYLTPKVRRQKLPY-DSFVEDDLYQYHPQELAEKYNAsmEEEgNWYIFTQRIRKYANGGRPNRSAGLGYWKATSSDQKIL 125
                     9****************************.778899**********8544432233359************************************ PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     +++g+++g kk+Lv+++g++p gekt Wvm+ey++
  XP_010927035.1 126 DREGKKIGYKKSLVYHEGKQPYGEKTGWVMQEYKI 160
                     *********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-4627165IPR003441NAC domain
PROSITE profilePS5100544.64131175IPR003441NAC domain
PfamPF023653.4E-2432160IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MELLAPDQIS EEETKMEAEW QSYSRYWPPP YPPGVRFTPT DEELVKYYLT PKVRRQKLPY  60
DSFVEDDLYQ YHPQELAEKY NASMEEEGNW YIFTQRIRKY ANGGRPNRSA GLGYWKATSS  120
DQKILDREGK KIGYKKSLVY HEGKQPYGEK TGWVMQEYKI DESQKPIKAK SMVVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-383216016140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010927035.11e-127PREDICTED: NAC domain-containing protein 68-like
SwissprotQ52QH42e-38NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLM1DSS77e-43M1DSS7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000938222e-42(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP131302130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.13e-38NAC domain containing protein 32